DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and NANOGP8

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001342210.1 Gene:NANOGP8 / 388112 HGNCID:23106 Length:305 Species:Homo sapiens


Alignment Length:168 Identity:38/168 - (22%)
Similarity:68/168 - (40%) Gaps:34/168 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 QQQSGVPPVGAP----PQGMMHQGQGP--------PQ----MHQGHPGQHT-PPSQNPNSQSSGM 279
            ::.|.:|.:..|    |...|...:.|        |.    :.|..|...| |..:.|.|..:.:
Human    20 KESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAENSV 84

  Fly   280 PS-----PLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTER 339
            ..     |:            ::::.|..::..|...|...|...:||:.::..|:::.|.|:.:
Human    85 AKKEDKVPV------------KKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYK 137

  Fly   340 QIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNSP 377
            |:|.||||:|||.|:..|......|.|...:.:.|..|
Human   138 QVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYP 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 15/95 (16%)
Homeodomain 298..354 CDD:459649 18/55 (33%)
NANOGP8NP_001342210.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 14/87 (16%)
Homeodomain 97..152 CDD:459649 18/54 (33%)
8 X repeats starting with a Trp in each unit 196..240
Sufficient for transactivation activity. /evidence=ECO:0000250 196..240
Sufficient for strong transactivation activity. /evidence=ECO:0000250 241..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.