DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Awh

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001261379.1 Gene:Awh / 38451 FlyBaseID:FBgn0013751 Length:287 Species:Drosophila melanogaster


Alignment Length:72 Identity:23/72 - (31%)
Similarity:34/72 - (47%) Gaps:5/72 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-----ENK 357
            ||.|.|:|..|...|:..|..:.....:....||....|::|..::||||.|.:.||     :||
  Fly   149 KRVRTTFTEEQLQVLQANFQIDSNPDGQDLERIASVTGLSKRVTQVWFQNSRARQKKHIHAGKNK 213

  Fly   358 TKGEPGS 364
            .:...||
  Fly   214 IREPEGS 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 4/7 (57%)
Homeodomain 298..354 CDD:459649 17/55 (31%)
AwhNP_001261379.1 LIM1_AWH 8..61 CDD:188759
LIM2_AWH 69..123 CDD:188765
Homeodomain 149..205 CDD:459649 17/55 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.