DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and vax2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_919390.1 Gene:vax2 / 373869 ZFINID:ZDB-GENE-030904-8 Length:307 Species:Danio rerio


Alignment Length:78 Identity:30/78 - (38%)
Similarity:42/78 - (53%) Gaps:0/78 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEP 362
            ||.|.::|..|...||.||...:|:..|.|.|:|..|.|:|.|:|:||||||.|.||:.....:.
Zfish   104 KRTRTSFTAEQLYRLELEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQTKDTDK 168

  Fly   363 GSGGEGDEITPPN 375
            .|....:.:...|
Zfish   169 RSSSTSESLATCN 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/7 (43%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
vax2NP_919390.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Homeodomain 104..160 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 155..175 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..254
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.