DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and PDX1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_000200.1 Gene:PDX1 / 3651 HGNCID:6107 Length:283 Species:Homo sapiens


Alignment Length:302 Identity:90/302 - (29%)
Similarity:114/302 - (37%) Gaps:122/302 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 QQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAV---------------GGLGMVPEGGS------ 179
            ::|....||....|...|:.|....|....|.:               |.||.:.:|..      
Human     4 EEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGRQPPPPPPHPFPGALGALEQGSPPDISPY 68

  Fly   180 --PPLVDQMS----GHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVP 238
              |||.|..:    .||:.||:.|||                                      |
Human    69 EVPPLADDPAVAHLHHHLPAQLALPH--------------------------------------P 95

  Fly   239 PVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS--QNPNSQSSGMPSPLYPWMRS------------ 289
            |.|..|:|             ..||....|:  |.|           :|||:|            
Human    96 PAGPFPEG-------------AEPGVLEEPNRVQLP-----------FPWMKSTKAHAWKGQWAG 136

  Fly   290 --QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKW 352
              ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.||||||||||||
Human   137 GAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKW 201

  Fly   353 KK-ENKTKG---EPGSGG-----------EGDEI--TPPNSP 377
            || |:|.:|   ..|.||           .|:|:  .||..|
Human   202 KKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPPPPP 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/187 (19%)
Homeobox 301..354 CDD:395001 37/52 (71%)
PDX1NP_000200.1 Transactivation domain. /evidence=ECO:0000250 13..73 10/59 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 34..71 5/36 (14%)
Antp-type hexapeptide 118..123 3/15 (20%)
Homeobox 149..202 CDD:278475 36/52 (69%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 14/43 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.