DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Gsx2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001131035.2 Gene:Gsx2 / 364140 RGDID:1308047 Length:305 Species:Rattus norvegicus


Alignment Length:263 Identity:78/263 - (29%)
Similarity:95/263 - (36%) Gaps:101/263 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 AAVGGLGMVPEGGSPPLV-DQMSGHHMNAQ----MTLPHHMGH-PQAQLGYTDVGVPDVTEVHQN 224
            |||.|.|:....|:.||: .|.|....:||    ::..||..| ||                |.:
  Rat    88 AAVAGGGVAGGTGALPLLKSQFSPGPGDAQFCPRVSHAHHHHHAPQ----------------HHH 136

  Fly   225 HHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTP---------------------- 267
            ||:.   .||.|.....|....    .........|||..|.|                      
  Rat   137 HHHQ---PQQPGSAAAAAAAAA----AAAAAAAALGHPQHHAPVCAATTYNVSDPRRFHCLTMGG 194

  Fly   268 --PSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEI 330
              .||.||.                       ||.|..:|..|.||||:||..|.||:|.|||||
  Rat   195 SDTSQVPNG-----------------------KRMRTAFTSTQLLELEREFSSNMYLSRLRRIEI 236

  Fly   331 AHALCLTERQIKIWFQNRRMKWKKENK-------------------TKGE------PGSGGEGDE 370
            |..|.|:|:|:||||||||:|.|||.|                   .:.|      |.|..|..|
  Rat   237 ATYLNLSEKQVKIWFQNRRVKHKKEGKGASRNNHASCKCVGSQAHYARSEDEDSLSPASANEDKE 301

  Fly   371 ITP 373
            |:|
  Rat   302 ISP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/169 (21%)
Homeobox 301..354 CDD:395001 32/52 (62%)
Gsx2NP_001131035.2 Homeobox 207..260 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.