DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Meox1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001102307.1 Gene:Meox1 / 363684 RGDID:1308911 Length:253 Species:Rattus norvegicus


Alignment Length:311 Identity:79/311 - (25%)
Similarity:109/311 - (35%) Gaps:87/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 RPDSPSSQVGGVM--PQAQTNGQLGVPQQQ------QQQQQQPSQNQQQQQAQQAPQQLQQQLPQ 141
            |...|.:.|.|.:  |.::.:...|:|...      .|:...|:.......:..........||:
  Rat    10 RNPQPPAPVWGCLRNPHSEGSSASGLPHYPPTPFSFHQKSDFPATAAYPDFSTSCLAATPHSLPR 74

  Fly   142 VTQ--QVTHPQQQQQQ----PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH 200
            ..:  ...||...|..    |:..|..:|.....|.......|||.|||...|            
  Rat    75 AERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTGG------------ 127

  Fly   201 MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQH 265
            :|.....||         |..|:....:...:::.                              
  Rat   128 LGEDCMVLG---------TIAHETEKKLSRRKKER------------------------------ 153

  Fly   266 TPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEI 330
               |.||.: ..|.|.          |..:.||. |..:|:.|..|||.||..:.||||.||.||
  Rat   154 ---SDNPEN-GGGKPE----------GSSKARKE-RTAFTKEQLRELEAEFAHHNYLTRLRRYEI 203

  Fly   331 AHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE-----GDEITPPNS 376
            |..|.|:|||:|:||||||||||:..  .|:|.|..|     ||....|:|
  Rat   204 AVNLDLSERQVKVWFQNRRMKWKRVK--GGQPVSPQEQDPEDGDSAASPSS 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 23/144 (16%)
Homeobox 301..354 CDD:395001 32/52 (62%)
Meox1NP_001102307.1 COG5576 139..251 CDD:227863 48/158 (30%)
Homeobox 174..227 CDD:395001 32/52 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.