DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ap

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_724428.1 Gene:ap / 35509 FlyBaseID:FBgn0267978 Length:469 Species:Drosophila melanogaster


Alignment Length:185 Identity:43/185 - (23%)
Similarity:67/185 - (36%) Gaps:43/185 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 YQQQSGVP------PVGAP-----PQGMM----HQGQGPPQ--MHQGHPGQHTPPSQNPNSQSSG 278
            |..|.|.|      |...|     |.|:.    |...|.||  ..:|.|.:..|......:.:..
  Fly   283 YSAQFGSPHNDSSSPHSDPSRSIVPTGIFVPASHVINGLPQPARQKGRPRKRKPKDIEAFTANID 347

  Fly   279 MPSPLYPWMR-SQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIK 342
            :.:....:.| |........||.|.::..:|...::..|..|.....:...:::....|.:|.::
  Fly   348 LNTEYVDFGRGSHLSSSSRTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLSQKTGLPKRVLQ 412

  Fly   343 IWFQNRRMKWKKENKTKGEPGSG----GEG----DEI---------------TPP 374
            :||||.|.||::  ....:.|||    |||    |.|               |||
  Fly   413 VWFQNARAKWRR--MMMKQDGSGLLEKGEGALDLDSISVHSPTSFILGGPNSTPP 465

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/92 (22%)
Homeodomain 298..354 CDD:459649 15/55 (27%)
apNP_724428.1 LIM1_Lhx2_Lhx9 148..201 CDD:188755
LIM2_Lhx2_Lhx9 206..264 CDD:188763
Homeodomain 368..424 CDD:459649 15/55 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.