DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and cad

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001260641.1 Gene:cad / 35341 FlyBaseID:FBgn0000251 Length:445 Species:Drosophila melanogaster


Alignment Length:382 Identity:91/382 - (23%)
Similarity:139/382 - (36%) Gaps:92/382 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 HHGHYPGNG--VTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPD 87
            ::.|.|.|.  :.|:|:....|::. |.||              .|||...|.............
  Fly    35 NYHHTPPNHQFLGDVDSSHAAHHAA-AAHQ--------------MYYNSHHMFHSAAAASAGEWH 84

  Fly    88 SPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQQLQQQ-----LPQVTQQVT 147
            ||:|.......|       .||....|..||...:.....:..|.......     .||:.:   
  Fly    85 SPASSTADNFVQ-------NVPTSAHQLMQQHHHHHAHASSSSASSGSSSSGGAPGAPQLNE--- 139

  Fly   148 HPQQQQQQPVVYASCKLQAA--VGGLGMVPEGG---SPPLVDQMSGHHMNAQMTLPHHMGHPQAQ 207
                      ..:|..:..|  .||:|...:||   :||          |.|..:...:..|...
  Fly   140 ----------TNSSIGVGGAGGGGGVGGATDGGPGSAPP----------NHQQHIAEGLPSPPIT 184

  Fly   208 LGYTDVGVPDV-TEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQN 271
            :..:::..|.. |.....||::.  ...|.|    |......:.....|..|..:...:   |.:
  Fly   185 VSGSEISSPGAPTSASSPHHHLA--HHLSAV----ANNNNNNNNNNNSPSTHNNNNNNN---SVS 240

  Fly   272 PNSQSSGMPSPLYPWMR-------------------------SQFGKCQERKRGRQTYTRYQTLE 311
            .|:::|....|.:.||:                         ...||.:.:.:.|..||.:|.||
  Fly   241 NNNRTSPSKPPYFDWMKKPAYPAQPQPDLSSSPNLEDLSDLLDASGKTRTKDKYRVVYTDFQRLE 305

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG 368
            ||||:..:||:|.||:.|:|..|.|:|||:||||||||.|.:|:||...:|...|.|
  Fly   306 LEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNKKGSDPNVMGVG 362

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/175 (18%)
Homeobox 301..354 CDD:395001 31/52 (60%)
cadNP_001260641.1 Homeobox 295..347 CDD:278475 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 53 1.000 Domainoid score I4196
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
32.910

Return to query results.
Submit another query.