DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and prd

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_723721.1 Gene:prd / 34629 FlyBaseID:FBgn0003145 Length:613 Species:Drosophila melanogaster


Alignment Length:146 Identity:37/146 - (25%)
Similarity:59/146 - (40%) Gaps:27/146 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 APPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS------QSSGMPSPLYPWMRSQFGKCQ----- 295
            ||....|....|.|      .|..|..|.:..|      .::|.||.      .....|:     
  Fly   155 APLDNDMSSASGSP------AGDGTKASSSCGSDVSGGHHNNGKPSD------EDISDCESEPGI 207

  Fly   296 ----ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 356
                :::|.|.|::..|..|||:.|...:|.....|.|:|....|||.:|::||.|||.:.:|::
  Fly   208 ALKRKQRRCRTTFSASQLDELERAFERTQYPDIYTREELAQRTNLTEARIQVWFSNRRARLRKQH 272

  Fly   357 KTKGEPGSGGEGDEIT 372
            .:......||....::
  Fly   273 TSVSGGAPGGAAASVS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/78 (21%)
Homeodomain 298..354 CDD:459649 21/55 (38%)
prdNP_723721.1 PAX 27..154 CDD:238076
Homeodomain 214..270 CDD:459649 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.