DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXD9

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_055028.3 Gene:HOXD9 / 3235 HGNCID:5140 Length:352 Species:Homo sapiens


Alignment Length:126 Identity:58/126 - (46%)
Similarity:69/126 - (54%) Gaps:25/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 GQGPPQMHQGHP----------GQHTPPSQ---NPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQ 302
            |...|.....||          .||:.|.|   :||       :|...|:.::    ..||: |.
Human   238 GSSEPSACSDHPIPGCSLKEEEKQHSQPQQQQLDPN-------NPAANWIHAR----STRKK-RC 290

  Fly   303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG 363
            .||:||||||||||.||.||||.||.|:|..|.|||||:||||||||||.||.:|.|...|
Human   291 PYTKYQTLELEKEFLFNMYLTRDRRYEVARILNLTERQVKIWFQNRRMKMKKMSKEKCPKG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/67 (24%)
Homeodomain 298..354 CDD:459649 40/55 (73%)
HOXD9NP_055028.3 Hox9_act 11..>164 CDD:461369
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 126..208
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 229..276 10/44 (23%)
Homeodomain 286..337 CDD:459649 37/51 (73%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.