DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXD8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_062458.1 Gene:HOXD8 / 3234 HGNCID:5139 Length:290 Species:Homo sapiens


Alignment Length:277 Identity:93/277 - (33%)
Similarity:113/277 - (40%) Gaps:93/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 KLQAAVGGLGMVPEGGSPPLVD-----QMSGHHMNAQMTLPHHMGHPQAQL-GYTDVGVPDV-TE 220
            |.:||........|..:|...|     ::.|.|..|...|         || |.:..|.|.. .:
Human    12 KYKAAAAAAAAAGEAINPTYYDCHFAPEVGGRHAAAAAAL---------QLYGNSAAGFPHAPPQ 67

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQG----------------HPGQHTPPS 269
            .|.:.|        ...||.|....|  .:|:|....|.|                ||....||.
Human    68 AHAHPH--------PSPPPSGTGCGG--REGRGQEYFHPGGGSPAAAYQAAPPPPPHPPPPPPPP 122

  Fly   270 -----------------------------------QNPNSQS--------------SGMPSPLYP 285
                                               |.|:.:|              |..||.::|
Human   123 PCGGIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQMFP 187

  Fly   286 WMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRM 350
            |||.|  ....|:||||||:|:|||||||||.||.||||:||||::|||.|||||:|||||||||
Human   188 WMRPQ--AAPGRRRGRQTYSRFQTLELEKEFLFNPYLTRKRRIEVSHALALTERQVKIWFQNRRM 250

  Fly   351 KWKKENKTKGEPGSGGE 367
            ||||||.....|.|..|
Human   251 KWKKENNKDKFPVSRQE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 47/214 (22%)
Homeobox 301..354 CDD:395001 43/52 (83%)
HOXD8NP_062458.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 60..127 16/76 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..200 10/40 (25%)
Homeobox 201..253 CDD:278475 42/51 (82%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 255..290 5/13 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.