DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXD4

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_055436.2 Gene:HOXD4 / 3233 HGNCID:5138 Length:255 Species:Homo sapiens


Alignment Length:237 Identity:87/237 - (36%)
Similarity:106/237 - (44%) Gaps:56/237 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQ---------S 235
            ||..:.:.|.::..| ...::.|..|.    .|...|            |:|.:.         |
Human    18 PPCEEYLQGGYLGEQ-GADYYGGGAQG----ADFQPP------------GLYPRPDFGEQPFGGS 65

  Fly   236 GVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTP--------------------PSQNPNSQSSGMP 280
            |..|..|.|.....|..|.|..|...||:..|                    |.|.|:..:...|
Human    66 GPGPGSALPARGHGQEPGGPGGHYAAPGEPCPAPPAPPPAPLPGARAYSQSDPKQPPSGTALKQP 130

  Fly   281 SPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTE 338
            :.:||||:......       .|.||.|..|||.|.|||||||||||||||||||||||.|||:|
Human   131 AVVYPWMKKVHVNSVNPNYTGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSE 195

  Fly   339 RQIKIWFQNRRMKWKKENK---TKGEPGSGGEGDEITPPNSP 377
            ||||||||||||||||::|   |||...|.......:...:|
Human   196 RQIKIWFQNRRMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAP 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/161 (22%)
Homeobox 301..354 CDD:395001 46/52 (88%)
HOXD4NP_055436.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..127 22/112 (20%)
Antp-type hexapeptide 133..138 3/4 (75%)
Homeobox 157..210 CDD:306543 45/52 (87%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 212..255 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.