DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXD1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_078777.1 Gene:HOXD1 / 3231 HGNCID:5132 Length:328 Species:Homo sapiens


Alignment Length:244 Identity:70/244 - (28%)
Similarity:94/244 - (38%) Gaps:81/244 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YASCKLQ----------AAVGG-----LGMVPEGGSPPLVDQMS---GHHMNAQMTLPHHMGHP- 204
            ||.|.|:          ||.||     ||..|....|.::.:.:   |.|::...:.....|.. 
Human    82 YAQCTLEGAYEPGAAPAAAAGGADYGFLGSGPAYDFPGVLGRAADDGGSHVHYATSAVFSGGGSF 146

  Fly   205 --QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGP-----PQMHQGHP 262
              ..|:.|...|.|                                    ||     .....|||
Human   147 LLSGQVDYAAFGEP------------------------------------GPFPACLKASADGHP 175

  Fly   263 GQHTPPSQNPN------SQSSGMPSPL--YPWMR-----------SQFGKCQERKRGRQTYTRYQ 308
            |.....|..|.      |.:||:|:..  :.||:           :::|........|..::..|
Human   176 GAFQTASPAPGTYPKSVSPASGLPAAFSTFEWMKVKRNASKKGKLAEYGAASPSSAIRTNFSTKQ 240

  Fly   309 TLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357
            ..|||||||||:||||.||||||:.|.|.:.|:||||||||||.||..:
Human   241 LTELEKEFHFNKYLTRARRIEIANCLHLNDTQVKIWFQNRRMKQKKRER 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/189 (17%)
Homeobox 301..354 CDD:395001 34/52 (65%)
HOXD1NP_078777.1 Antp-type hexapeptide 204..209 1/4 (25%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..328
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.