Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076921.1 | Gene: | HOXB8 / 3218 | HGNCID: | 5119 | Length: | 243 | Species: | Homo sapiens |
Alignment Length: | 201 | Identity: | 81/201 - (40%) |
---|---|---|---|
Similarity: | 99/201 - (49%) | Gaps: | 55/201 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 224 NHHNMGMYQQQSGVPPVGAPPQ---GMMHQGQ------GPPQMH-------------QGHPG--- 263
Fly 264 -------QHTPPSQNPN---------------------SQSSGMPSPLYPWMRSQFGKCQERKRG 300
Fly 301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG 365
Fly 366 GEGDEI 371 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 33/134 (25%) |
Homeobox | 301..354 | CDD:395001 | 44/52 (85%) | ||
HOXB8 | NP_076921.1 | Antp-type hexapeptide | 134..139 | 3/4 (75%) | |
Homeobox | 150..203 | CDD:395001 | 44/52 (85%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 203..243 | 7/18 (39%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 123 | 1.000 | Inparanoid score | I4737 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.860 |