DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXB4

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_076920.1 Gene:HOXB4 / 3214 HGNCID:5115 Length:251 Species:Homo sapiens


Alignment Length:234 Identity:90/234 - (38%)
Similarity:105/234 - (44%) Gaps:67/234 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 YTDVGVPDVTEVHQ-----NHHNMGMY----------QQQSGV---------------------- 237
            |.|...|...|..|     :.|:.|.|          |.::|.                      
Human    12 YVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESSFQPEAGFGRRAACTVQRYAACRDPGPPPP 76

  Fly   238 ---PPVGAPPQGMMHQGQGPPQMHQ--GHPGQH-----TPPSQNPNSQSSGMPSP---------L 283
               ||...||.|:..:...||....  ..|||.     :.|...|.:|:...|||         :
Human    77 PPPPPPPPPPPGLSPRAPAPPPAGALLPEPGQRCEAVSSSPPPPPCAQNPLHPSPSHSACKEPVV 141

  Fly   284 YPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQI 341
            |||||......       .|.||.|..|||.|.||||||||:|||||||||:||||||||:||||
Human   142 YPWMRKVHVSTVNPNYAGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQI 206

  Fly   342 KIWFQNRRMKWKKENK---TKGEPGSGGEGDEITPPNSP 377
            |||||||||||||::|   ||...| |..|....||..|
Human   207 KIWFQNRRMKWKKDHKLPNTKIRSG-GAAGSAGGPPGRP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 36/158 (23%)
Homeobox 301..354 CDD:395001 45/52 (87%)
HOXB4NP_076920.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134 26/121 (21%)
Antp-type hexapeptide 141..146 3/4 (75%)
Homeobox 165..218 CDD:278475 44/52 (85%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 220..251 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.