DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXB2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_002136.1 Gene:HOXB2 / 3212 HGNCID:5113 Length:356 Species:Homo sapiens


Alignment Length:219 Identity:66/219 - (30%)
Similarity:88/219 - (40%) Gaps:80/219 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 PDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS--QNPNSQS-- 276
            |.|.|..|.    ...::.:.:||              ||...|..|......|  |.|.||.  
Human    26 PAVLETFQT----SSIKESTLIPP--------------PPPFEQTFPSLQPGASTLQRPRSQKRA 72

  Fly   277 ---------------SGMPSPLYPWMRSQFGKCQER----------------------------- 297
                           :..|:|.:|||:.:  |..::                             
Human    73 EDGPALPPPPPPPLPAAPPAPEFPWMKEK--KSAKKPSQSATSPSPAASAVPASGVGSPADGLGL 135

  Fly   298 --------KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
                    :|.|..||..|.||||||||||:||.|.||:|||..|.|||||:|:||||||||.|:
Human   136 PEAGGGGARRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKR 200

  Fly   355 ENKTK----GEPGSGGEGDEITPP 374
            :.:.:    |||...|..::|..|
Human   201 QTQHREPPDGEPACPGALEDICDP 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 24/145 (17%)
Homeobox 301..354 CDD:395001 37/52 (71%)
HOXB2NP_002136.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..142 17/118 (14%)
Antp-type hexapeptide 94..99 2/4 (50%)
Homeobox 147..199 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 197..240 8/28 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.