DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and HOXA5

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_061975.2 Gene:HOXA5 / 3202 HGNCID:5106 Length:270 Species:Homo sapiens


Alignment Length:370 Identity:115/370 - (31%)
Similarity:143/370 - (38%) Gaps:134/370 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTSYFTNSYMGADMHHGHYPGNGVTDLDAQQMHHYSQNAN-----------HQGNMPYPRFPPYD 64
            |:|||.||:.      |.|| ||    ...|:|:|..:::           |.|...|.      
Human     1 MSSYFVNSFC------GRYP-NG----PDYQLHNYGDHSSVSEQFRDSASMHSGRYGYG------ 48

  Fly    65 RMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQ 129
                |||..:                 .||     ...:|..|..::.:         .....|.
Human    49 ----YNGMDL-----------------SVG-----RSGSGHFGSGERAR---------SYAASAS 78

  Fly   130 QAPQQLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQ 194
            .||.:     |:.:|..|.....|..|:   .|.        .:.|..||       ..|| ..:
Human    79 AAPAE-----PRYSQPATSTHSPQPDPL---PCS--------AVAPSPGS-------DSHH-GGK 119

  Fly   195 MTLPHHMGHPQAQLGYTDV----GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPP 255
            .:|.:..| ..|..|.|.:    ||...:...::                 ||........|..|
Human   120 NSLSNSSG-ASADAGSTHISSREGVGTASGAEED-----------------APASSEQASAQSEP 166

  Fly   256 QMHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR------SQFGKCQERKRGRQTYTRYQTLELEK 314
                    ...||:|          ..:|||||      ...|. .|.||.|..|||||||||||
Human   167 --------SPAPPAQ----------PQIYPWMRKLHISHDNIGG-PEGKRARTAYTRYQTLELEK 212

  Fly   315 EFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            ||||||||||||||||||||||:|||||||||||||||||:||.|
Human   213 EFHFNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/154 (20%)
Homeobox 301..354 CDD:395001 49/52 (94%)
HOXA5NP_061975.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..175 28/159 (18%)
Antp-type hexapeptide 176..181 3/4 (75%)
Homeobox 199..251 CDD:306543 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.