DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and pdx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571518.2 Gene:pdx1 / 30721 ZFINID:ZDB-GENE-990415-122 Length:246 Species:Danio rerio


Alignment Length:221 Identity:69/221 - (31%)
Similarity:91/221 - (41%) Gaps:75/221 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPP 244
            ||.:.....|.:.|            :.||..|  .|::|::  ..:||......:|        
Zfish    33 PPCLYMRQAHSVYA------------SPLGAQD--QPNLTDI--TSYNMSSRDDLAG-------- 73

  Fly   245 QGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSG----------------MPSPLYPWMRS---- 289
                             |..|.|.:...:.||.|                :|   :|||:|    
Zfish    74 -----------------PHLHLPQTSQTSLQSLGGYGDSLDLCGDRNRYHLP---FPWMKSTKSH 118

  Fly   290 -----------QFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343
                       ...:.:|.||.|..|||.|.|||||||.||:|::|.||:|:|..|.||||.|||
Zfish   119 THAWKGQWTGPYMVEAEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELALTLSLTERHIKI 183

  Fly   344 WFQNRRMKWKKENKTKGEPGSGGEGD 369
            ||||||||||||...:...|...|.|
Zfish   184 WFQNRRMKWKKEEDKRRARGVDPEQD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/156 (18%)
Homeobox 301..354 CDD:395001 37/52 (71%)
pdx1NP_571518.2 Homeobox 140..193 CDD:278475 36/52 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.