DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and nkx2.5

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571496.2 Gene:nkx2.5 / 30696 ZFINID:ZDB-GENE-980526-321 Length:314 Species:Danio rerio


Alignment Length:105 Identity:33/105 - (31%)
Similarity:49/105 - (46%) Gaps:23/105 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 RSQFGKCQE------------------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 334
            :...|.|||                  |::.|..:::.|..|||:.|...:||:...|..:|:.|
Zfish   114 KKDIGCCQEDPGEDLKLDDAERPKQRKRRKPRVLFSQAQVYELERRFKQQKYLSAPERDHLANVL 178

  Fly   335 CLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPP 374
            .||..|:||||||||.|.|::.:.:.....|     |.||
Zfish   179 KLTSTQVKIWFQNRRYKCKRQRQDQTLEMVG-----IAPP 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 6/35 (17%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
nkx2.5NP_571496.2 Homeodomain 142..198 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.