DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and rx3

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571302.1 Gene:rx3 / 30474 ZFINID:ZDB-GENE-990415-238 Length:292 Species:Danio rerio


Alignment Length:111 Identity:35/111 - (31%)
Similarity:55/111 - (49%) Gaps:15/111 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   260 GHPGQHTPPSQNPNSQSSG------MPSPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLE 311
            |...:|..|.::.|....|      |.||..|  .:..||.       ::.:|.|.|:|.:|..|
Zfish    58 GKDTEHLSPKKDSNKHFDGVCRSTVMVSPDLP--DADGGKLSDDENPKKKHRRNRTTFTTFQLHE 120

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK 357
            ||:.|..:.|.....|.|:|..:.|.|.::::||||||.||:::.|
Zfish   121 LERAFEKSHYPDVYSREELALKVNLPEVRVQVWFQNRRAKWRRQEK 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 14/58 (24%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
rx3NP_571302.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..27
Octapeptide motif 32..39
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..72 3/13 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..107 5/23 (22%)
Homeodomain 107..163 CDD:459649 23/55 (42%)
OAR 268..284 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 272..285
Nuclear localization signal. /evidence=ECO:0000255 278..282
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.