DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxc3a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001128157.2 Gene:hoxc3a / 30421 ZFINID:ZDB-GENE-980526-532 Length:263 Species:Danio rerio


Alignment Length:243 Identity:73/243 - (30%)
Similarity:95/243 - (39%) Gaps:85/243 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   161 SCKLQ------AAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMG--------------HPQ 205
            :|.||      .|:||                 |||:....||   :|              |.:
Zfish    19 TCSLQLKHRVRKAIGG-----------------GHHVTTLFTL---VGKQLKTRENSSTWKRHAE 63

  Fly   206 AQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQ 270
            ......|.|            |:..:|..|.|    ..|......|.     |...|.......:
Zfish    64 ESSSENDKG------------NVWNFQNLSNV----QHPYSFSDDGN-----HSLDPANALEREK 107

  Fly   271 NPNSQSSGMPSPLYPWMR------------------SQF--GKCQER----KRGRQTYTRYQTLE 311
            .....:|.:.:..|||||                  |::  |:...|    ||.|..:|..|.||
Zfish   108 ACELSTSCLSTMKYPWMRETHAPTHFSSINAMESGDSKYSNGEAVVRNSSSKRARVAFTSSQLLE 172

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            |||||||:.||.|.||:|:|..|.||:|||||||||||||:||::|.|
Zfish   173 LEKEFHFSAYLCRNRRLEMAELLKLTDRQIKIWFQNRRMKYKKDHKEK 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/188 (19%)
Homeobox 301..354 CDD:395001 35/52 (67%)
hoxc3aNP_001128157.2 Abdominal-A 123..246 CDD:332641 47/98 (48%)
Homeobox 162..214 CDD:306543 35/51 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.