| Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571256.1 | Gene: | hoxb8b / 30420 | ZFINID: | ZDB-GENE-980526-291 | Length: | 247 | Species: | Danio rerio |
| Alignment Length: | 199 | Identity: | 79/199 - (39%) |
|---|---|---|---|
| Similarity: | 94/199 - (47%) | Gaps: | 61/199 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 231 YQQQSGVPPVGAPP---------QGMMHQGQGPPQMHQG-----------------HPGQHT--- 266
Fly 267 --------------PPSQ-----NPNSQSSGM----------PSPLYPWMRSQFGKCQERKRGRQ 302
Fly 303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGE 367
Fly 368 GDEI 371 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 31/132 (23%) |
| Homeodomain | 298..354 | CDD:459649 | 46/55 (84%) | ||
| hoxb8b | NP_571256.1 | Antp-type hexapeptide | 134..139 | 3/4 (75%) | |
| Homeodomain | 146..202 | CDD:459649 | 46/55 (84%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 201..247 | 8/19 (42%) |