Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571235.1 | Gene: | pou3f2b / 30397 | ZFINID: | ZDB-GENE-980526-370 | Length: | 378 | Species: | Danio rerio |
Alignment Length: | 363 | Identity: | 67/363 - (18%) |
---|---|---|---|
Similarity: | 103/363 - (28%) | Gaps: | 172/363 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 119 PSQNQQQQQAQQAPQ---------QLQQQLPQVTQQVTHPQQQQQ-------------------Q 155
Fly 156 PVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220
Fly 221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLYP 285
Fly 286 WMRSQFGKCQERKR----------------------GRQTYTRYQTLE----------------- 311
Fly 312 ------------LEKEFHFNRYLTRRRRIEI------------------------AHALCLTERQ 340
Fly 341 IKIWFQNRRMKWKKENKTKGEPGSGGE---GDEITPPN 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 27/166 (16%) |
Homeobox | 301..354 | CDD:395001 | 18/105 (17%) | ||
pou3f2b | NP_571235.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..28 | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..118 | 7/32 (22%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 151..205 | 19/95 (20%) | |||
POU | 200..274 | CDD:197673 | 10/89 (11%) | ||
Homeobox | 295..348 | CDD:278475 | 12/53 (23%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 347..378 | 10/26 (38%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R3844 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |