DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb3

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001100512.1 Gene:Hoxb3 / 303488 RGDID:1310780 Length:429 Species:Rattus norvegicus


Alignment Length:284 Identity:84/284 - (29%)
Similarity:109/284 - (38%) Gaps:101/284 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 QQVTHPQQQQQQPVVYASCKLQAAVGGLG-MVPEGGSPPLVDQMSGHHMN---AQMTLPHHMGHP 204
            |..||.:...|:    ::|.||:    || ..|...|    .:::|..|.   |...||...|.|
  Rat    38 QAATHLEGDYQR----SACSLQS----LGNAAPHAKS----KELNGSCMRPGLAPEPLPAPPGSP 90

  Fly   205 QAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPS 269
                                             ||..||.....:...|      |.|.:..||.
  Rat    91 ---------------------------------PPSAAPTSTTSNSNNG------GGPSKSGPPK 116

  Fly   270 QNPNSQSSGMPSPLYPWMRS--QFGKCQE------------------------------------ 296
            ...:|.|: :...::|||:.  |..|.:.                                    
  Rat   117 CGASSNST-LTKQIFPWMKESRQTSKLKNSSPGTAEGCGGGGGGGGGGGSSSGGGGSGGGGGDKS 180

  Fly   297 ------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
                  .||.|..||..|.:||||||||||||.|.||:|:|:.|.|:||||||||||||||:||:
  Rat   181 PPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKD 245

  Fly   356 NKTKG-EPGSGGEGDEITPPNSPQ 378
            .|.|| ...|||.....:||...|
  Rat   246 QKAKGLASSSGGPSPAGSPPQPMQ 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/192 (18%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Hoxb3NP_001100512.1 Homeobox 191..244 CDD:395001 37/52 (71%)
DUF4074 365..427 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.