Sequence 1: | NP_996167.1 | Gene: | Antp / 40835 | FlyBaseID: | FBgn0260642 | Length: | 378 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_571192.2 | Gene: | hoxb3a / 30339 | ZFINID: | ZDB-GENE-990415-104 | Length: | 417 | Species: | Danio rerio |
Alignment Length: | 241 | Identity: | 81/241 - (33%) |
---|---|---|---|
Similarity: | 107/241 - (44%) | Gaps: | 82/241 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 209 GYTDVGVPDVTEVHQNH-HNMGMYQQQS-GVPPVG--APPQ----------GMMHQGQGPPQMHQ 259
Fly 260 GHPGQHTPP-----------SQNP-----------------NSQSSGMPS------PLYPWMRSQ 290
Fly 291 FGKCQER--------------------------KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 329
Fly 330 IAHALCLTERQIKIWFQNRRMKWKKENKTKG-EPGSGGEGDEITPP 374 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Antp | NP_996167.1 | KLF1_2_4_N | <161..306 | CDD:425360 | 36/170 (21%) |
Homeobox | 301..354 | CDD:395001 | 37/52 (71%) | ||
hoxb3a | NP_571192.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 51..135 | 19/85 (22%) | |
Antp-type hexapeptide | 140..145 | 2/4 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 147..184 | 2/36 (6%) | |||
Homeobox | 184..236 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..290 | 9/22 (41%) | |||
DUF4074 | 353..415 | CDD:290032 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 381..417 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X14 | |
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |