DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxb2a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571191.1 Gene:hoxb2a / 30338 ZFINID:ZDB-GENE-990415-103 Length:390 Species:Danio rerio


Alignment Length:171 Identity:67/171 - (39%)
Similarity:85/171 - (49%) Gaps:40/171 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 APPQGMMHQGQGPPQMHQGHPGQHTPP---------------------SQNPNSQSS-----GMP 280
            |||  ..|| |||..:..|.|..|..|                     :.:|:..||     |:.
Zfish    82 APP--TQHQ-QGPAPLSGGAPLAHEFPWMKEKKSSKKCPKPGATAAAAAASPSQASSGYTTAGLE 143

  Fly   281 SPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWF 345
            ||..  ::.........:|.|..||..|.||||||||||:||.|.||:|||..|.|||||:|:||
Zfish   144 SPTE--IQGGLDNVSGSRRLRTAYTNTQLLELEKEFHFNKYLCRPRRVEIAALLDLTERQVKVWF 206

  Fly   346 QNRRMKWKKE-----NKTKGEPGSGG---EGDEITPPNSPQ 378
            ||||||.|::     :..:||| ||.   ||.:.:.|.|.|
Zfish   207 QNRRMKHKRQTTHHRDGQEGEP-SGFDLLEGTDASSPYSSQ 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 21/89 (24%)
Homeobox 301..354 CDD:395001 37/52 (71%)
hoxb2aNP_571191.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 40..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 81..100 9/20 (45%)
Antp-type hexapeptide 103..108 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..155 6/48 (13%)
Homeobox 162..214 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 211..338 13/37 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.