DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxd4a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:247 Identity:93/247 - (37%)
Similarity:112/247 - (45%) Gaps:66/247 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 EGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPV 240
            |||......::|..::...|.:..:|.:.:    |.|...|...|..||.:    ..:||  |..
Zfish     2 EGGKKDNSRKISISYLQKLMAMSSYMVNSK----YVDPKFPPCEEYSQNSY----IPEQS--PGY 56

  Fly   241 GAPPQ--GMMHQG-----------------QGPPQMHQGH-PGQHTPPS-------QNPNSQSSG 278
            .:|.|  ...|.|                 ||.....:|| ..|.:.||       |.|..|.||
Zfish    57 YSPSQDTDFQHPGIYSRSNYSEQPYSCSTVQGSSVQPRGHVQDQASTPSPFPAQTEQCPAVQISG 121

  Fly   279 -------------------MPSPLYPWMRSQFGKC-------QERKRGRQTYTRYQTLELEKEFH 317
                               .|:.:||||:......       .|.||.|..|||.|.||||||||
Zfish   122 SRTGGQQQNTKTQNGIPTKQPAVVYPWMKKVHVTTVNPDYTGPEPKRSRTAYTRQQVLELEKEFH 186

  Fly   318 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENK---TKGEPGSGG 366
            |||||||||||||||.|||:|||||||||||||||||::|   |||...|.|
Zfish   187 FNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKGRSASVG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 41/182 (23%)
Homeobox 301..354 CDD:395001 46/52 (88%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 45/52 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.