DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxa2b

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571181.1 Gene:hoxa2b / 30325 ZFINID:ZDB-GENE-990415-98 Length:363 Species:Danio rerio


Alignment Length:194 Identity:72/194 - (37%)
Similarity:90/194 - (46%) Gaps:66/194 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   238 PPVGAPPQG-------MMHQGQGPPQMHQ--------GHPGQHTPPSQNPNSQSSGMPS----PL 283
            ||||...|.       :.|....||...|        .|| :|:.|.||||. |..:|:    |.
Zfish    26 PPVGDAFQSSSIKSSTLSHSTLIPPPFEQTIPSLNPGSHP-RHSRPKQNPNG-SCPLPAASLPPE 88

  Fly   284 YPWMRSQFGKCQER---------------------------------KRGRQTYTRYQTLELEKE 315
            ||||:.:  |..::                                 :|.|..||..|.||||||
Zfish    89 YPWMKEK--KASKKNQTTSTAATTDPGPLYFSPQGSPEISDGGSGATRRLRTAYTNTQLLELEKE 151

  Fly   316 FHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK------GEPGS----GGEGD 369
            ||||:||.|.||:|||..|.|||||:|:||||||||.|::.:.|      |:|.|    ||.||
Zfish   152 FHFNKYLCRPRRVEIAALLDLTERQVKVWFQNRRMKHKRQTQCKENHHGDGKPPSLEEAGGRGD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/119 (24%)
Homeodomain 298..354 CDD:459649 38/55 (69%)
hoxa2bNP_571181.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 42..132 20/93 (22%)
Antp-type hexapeptide 88..93 3/4 (75%)
Homeodomain 134..190 CDD:459649 38/55 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 186..218 11/30 (37%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 245..279
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.