DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and hoxb5a

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571176.2 Gene:hoxb5a / 30317 ZFINID:ZDB-GENE-980526-70 Length:275 Species:Danio rerio


Alignment Length:367 Identity:108/367 - (29%)
Similarity:142/367 - (38%) Gaps:123/367 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 MTSYFTNSYMGADMHHGHYPG-------NGVTDLDAQQMHHYSQNANHQGNMPYPRFPPYDRMPY 68
            |:|||.||:      .|.||.       |..|...|....:......|.|:..            
Zfish     1 MSSYFVNSF------SGRYPNGPDYQLLNYGTSSSAMNASYRDSGTMHSGSYG------------ 47

  Fly    69 YNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQLGVPQQQQQQQQQPSQNQQQQQAQQAPQ 133
            ||..|||..                   :.::.:.|..|......:..|.|:...:.:|......
Zfish    48 YNYNGMDLS-------------------VNRSTSTGHFGAVGDNSRVFQSPAPETRFRQPSSCSL 93

  Fly   134 QLQQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQ---MSGHHMNAQM 195
            ...:.||                     |....::|     |:|.||| .||   .:|:::|:..
Zfish    94 ASPEPLP---------------------CSNSESLG-----PKGSSPP-SDQSTTTAGNNLNSNT 131

  Fly   196 TLPHHMGHPQAQLGYTDV----GVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQ 256
                   |      :|::    ...:..|.....:|.....||.                     
Zfish   132 -------H------FTEIDEASASSETEEASHRANNSAPRTQQK--------------------- 162

  Fly   257 MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMR----SQFGKCQERKRGRQTYTRYQTLELEKEFH 317
                   |.|..:...::.|.|....::||||    |......:.||.|..||||||||||||||
Zfish   163 -------QETTATSTTSATSDGQAPQIFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFH 220

  Fly   318 FNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            |||||||||||||||||||:|||||||||||||||||:||.|
Zfish   221 FNRYLTRRRRIEIAHALCLSERQIKIWFQNRRMKWKKDNKLK 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 30/155 (19%)
Homeobox 301..354 CDD:395001 49/52 (94%)
hoxb5aNP_571176.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 70..181 26/178 (15%)
Antp-type hexapeptide 182..187 2/4 (50%)
Homeobox 204..256 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.910

Return to query results.
Submit another query.