DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and en2b

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_571115.1 Gene:en2b / 30238 ZFINID:ZDB-GENE-980526-40 Length:261 Species:Danio rerio


Alignment Length:92 Identity:38/92 - (41%)
Similarity:46/92 - (50%) Gaps:11/92 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   268 PSQNPNSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAH 332
            ||..|.|:.....:|           .:|.||.|..:|..|...|:.||..|||||.:||..:|.
Zfish   154 PSSGPRSRKPKKKTP-----------TKEDKRPRTAFTAEQLQRLKNEFQNNRYLTEQRRQALAQ 207

  Fly   333 ALCLTERQIKIWFQNRRMKWKKENKTK 359
            .|.|.|.||||||||:|.|.||....|
Zfish   208 ELGLNESQIKIWFQNKRAKIKKATGNK 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 9/37 (24%)
Homeodomain 298..354 CDD:459649 29/55 (53%)
en2bNP_571115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 53..125
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 152..176 8/32 (25%)
Homeodomain 173..229 CDD:459649 29/55 (53%)
Engrail_1_C_sig 230..260 CDD:431338 1/5 (20%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.