DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc12

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001100266.1 Gene:Hoxc12 / 300262 RGDID:1310539 Length:280 Species:Rattus norvegicus


Alignment Length:168 Identity:54/168 - (32%)
Similarity:79/168 - (47%) Gaps:46/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 GMYQQQSGVPPVGAPPQGMMH-QGQGPPQM------------HQGHPG-QHTPPS-QNPNSQSS- 277
            |:.:::.|..|...|...::. :..|||.:            ..|:.| .|.||| |:..|.|| 
  Rat   106 GLKREERGREPGAGPGAALLQLEPSGPPALGFKYDYPAGGGGGDGNTGPPHDPPSCQSLESDSSS 170

  Fly   278 ------------GMP----SPL----------YPWMRSQFGKCQERKRGRQTYTRYQTLELEKEF 316
                        |.|    |||          .||....   .:.||: |:.|::.|..|||.||
  Rat   171 SLLNEGNKGASAGDPGSLVSPLNPGGGLSASGAPWYPIH---SRSRKK-RKPYSKLQLAELEGEF 231

  Fly   317 HFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ..|.::||:||.|::..|.|:::|:||||||||||.|:
  Rat   232 LVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 28/118 (24%)
Homeodomain 298..354 CDD:459649 28/55 (51%)
Hoxc12NP_001100266.1 Homeodomain 213..269 CDD:459649 29/56 (52%)

Return to query results.
Submit another query.