DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Pdx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:280 Identity:90/280 - (32%)
Similarity:119/280 - (42%) Gaps:77/280 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 QQQLPQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGHHMNAQMTLPHH 200
            ::|....||....|...|:.||...|....|.: .:|..|....||   |.:|            
  Rat     4 EEQYYAATQLYKDPCAFQRGPVPEFSANPPACL-YMGRQPPPPPPP---QFAG------------ 52

  Fly   201 MGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQH 265
                  .||..:.|.|.         ::..|:    |||:...|.|.......|.|:...||   
  Rat    53 ------SLGTLEQGSPP---------DISPYE----VPPLADDPAGAHLHHHLPAQLGLAHP--- 95

  Fly   266 TPPSQNPN-SQSSGMPSPL-----YPWMRS--------------QFGKCQERKRGRQTYTRYQTL 310
             ||...|| :::.|:..|.     :|||:|              ...:.:|.||.|..|||.|.|
  Rat    96 -PPGPFPNGTETGGLEEPSRVHLPFPWMKSTKAHAWKSQWAGGAYAAEPEENKRTRTAYTRAQLL 159

  Fly   311 ELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE---NKTKGEPGSGGEGDE-- 370
            ||||||.||:|::|.||:|:|..|.||||.|||||||||||||||   .::.|....||.|:|  
  Rat   160 ELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKKRSSGTTSGGGGGEEPE 224

  Fly   371 -------------ITPPNSP 377
                         :.||..|
  Rat   225 QDCAVTSGEELLALPPPPPP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 37/164 (23%)
Homeobox 301..354 CDD:395001 37/52 (71%)
Pdx1NP_074043.4 Transactivation domain 13..73 19/94 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81 16/79 (20%)
Antp-type hexapeptide 118..123 2/4 (50%)
Homeobox 149..203 CDD:395001 37/53 (70%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 5/5 (100%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 12/44 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.