DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Meox2

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:280 Identity:77/280 - (27%)
Similarity:106/280 - (37%) Gaps:81/280 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PQVTQQVTHPQQQQQQPVVYASCKLQAAVGGLGMVPEGGSPPLVDQMSGH-HMNAQMTLPHHMGH 203
            |..|.|..||..|       :|..|......:. .||..:......::|: :........||.||
  Rat    12 PHATAQGLHPFSQ-------SSLALHGRSDHMS-YPELSTSSSSCIIAGYPNEEGMFASQHHRGH 68

  Fly   204 PQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQS--------GVPPVGAPPQGMMH------QGQGP 254
            .                 |.:||:...:|||.        .:|.:.:||....|      ...||
  Rat    69 H-----------------HHHHHHHHHHQQQQHQALQSNWHLPQMSSPPSAARHSLCLQPDSGGP 116

  Fly   255 PQMHQGHPGQHTPPSQNPNSQSSGMPSP--------------LYP---------WMRSQFGKCQE 296
            |::..      :||....||.|.|..:|              |.|         ..:|.....||
  Rat   117 PELGS------SPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEVEKRSGSKRKSDSSDSQE 175

  Fly   297 ----------RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 351
                      .::.|..:|:.|..|||.||..:.||||.||.|||..|.|||||:|:||||||||
  Rat   176 GNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK 240

  Fly   352 WKKENKTKGEPGSGGEGDEI 371
            ||:..  .|:.|:.....|:
  Rat   241 WKRVK--GGQQGAAAREKEL 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/192 (18%)
Homeobox 301..354 CDD:395001 33/52 (63%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 29/150 (19%)
Homeobox 190..243 CDD:395001 33/52 (63%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.