DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and GBX2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001476.2 Gene:GBX2 / 2637 HGNCID:4186 Length:348 Species:Homo sapiens


Alignment Length:121 Identity:48/121 - (39%)
Similarity:63/121 - (52%) Gaps:29/121 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   249 HQGQGPPQMHQGHPGQHTPPSQNP--NSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLE 311
            |:.:.|     ||..:.||||...  ::.|:|                 :.:|.|..:|..|.||
Human   219 HKEEDP-----GHALEETPPSSGAAGSTTSTG-----------------KNRRRRTAFTSEQLLE 261

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK-----ENKTKGEP 362
            ||||||..:||:...|.:|||||.|:|.|:||||||||.|||:     .|...|||
Human   262 LEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAGNANSKTGEP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 12/58 (21%)
Homeodomain 298..354 CDD:459649 33/55 (60%)
GBX2NP_001476.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..81
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..251 11/53 (21%)
Homeodomain 248..304 CDD:459649 33/55 (60%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.