DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Gbx1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001258382.1 Gene:Gbx1 / 246149 RGDID:621864 Length:425 Species:Rattus norvegicus


Alignment Length:367 Identity:88/367 - (23%)
Similarity:123/367 - (33%) Gaps:128/367 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 GNMPYPRFPPYDRMPYYNGQGMDQQQQHQVYSRPDSPSSQVGGVMPQAQTNGQL--GVPQQQQQQ 115
            |::.|..:|.:  |||                ||        .|:|||.....|  |:|      
  Rat    98 GHLLYTGYPMF--MPY----------------RP--------LVLPQALAPAPLPAGLP------ 130

  Fly   116 QQQPSQNQQQQQAQQAPQQLQQQLPQVTQQVTH-PQQQQQQPVVYASCKLQAAVGGLGMVPEGGS 179
            ...|..:...:.:......|.|.:|.:....|. |...:.....|...:|.||....        
  Rat   131 PLAPLASFAGRLSNTFCAGLGQAVPSMVALTTALPSFAEPPDAYYGPPELAAAAAAA-------- 187

  Fly   180 PPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPP 244
                         |..|:......|.|:  .|| |..|..|:      :...::.:..||...||
  Rat   188 -------------AASTVSRSNPEPPAR--RTD-GALDADEL------LPAREKVTEPPPPPPPP 230

  Fly   245 QGMMHQGQGPPQMHQGHPG-------------QHTPPSQNPN------------------SQSSG 278
                     ||...:..|.             :..||:..|.                  ..|:|
  Rat   231 ---------PPHFSETFPSLPAEGKVYSSDEEKLEPPAGEPAGSEPEEEGSGGDSEDSFLDSSAG 286

  Fly   279 MPSPLY---PWMRSQFGKCQER---------------KRGRQTYTRYQTLELEKEFHFNRYLTRR 325
            .|..|.   |.::...|...|.               :|.|..:|..|.||||||||..:||:..
  Rat   287 GPGALLGPKPKLKGSLGTGAEEGTPVATGVTTPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLT 351

  Fly   326 RRIEIAHALCLTERQIKIWFQNRRMKWKK-----ENKTKGEP 362
            .|.:|||||.|:|.|:||||||||.|||:     .:...|||
  Rat   352 ERSQIAHALKLSEVQVKIWFQNRRAKWKRIKAGNVSSRSGEP 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 31/193 (16%)
Homeobox 301..354 CDD:395001 32/52 (62%)
Gbx1NP_001258382.1 Homeobox 326..379 CDD:278475 31/52 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.