DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:219 Identity:86/219 - (39%)
Similarity:110/219 - (50%) Gaps:32/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   159 YASCKLQAAVG---GLGMVPEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYTDVGVPDVTE 220
            |..|:...:||   .|...|.|.:|..  |.:.||:   ....||.....:..||          
  Rat    23 YYDCRFPQSVGRSHALVYGPGGSAPGF--QHASHHV---QDFFHHGTSGISNSGY---------- 72

  Fly   221 VHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNS-------QSSG 278
             .||..::..:...|......|.|:..::..|....:.| :|  ....|.|.||       ..:.
  Rat    73 -QQNPCSLSCHGDASKFYGYEALPRQSLYGAQQEASVVQ-YP--DCKSSANTNSSEGQGHLNQNS 133

  Fly   279 MPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKI 343
            .||.::||||..   ...|:.|||||:|||||||||||.||.||||:||||::|||.|||||:||
  Rat   134 SPSLMFPWMRPH---APGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKI 195

  Fly   344 WFQNRRMKWKKENKTKGEPGSGGE 367
            |||||||||||||.....||:..|
  Rat   196 WFQNRRMKWKKENNKDKLPGARDE 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 38/154 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.