DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxc4

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:251 Identity:86/251 - (34%)
Similarity:103/251 - (41%) Gaps:95/251 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   210 YTDVGVPDVTEVHQN--------------------HHNMGMY----------QQQSGVPPVGAPP 244
            |.|...|...|..||                    ||:..:|          ::|.....:..|.
  Rat    12 YIDPKFPPCEEYSQNSYIPEHSPEYYGRTRESGFQHHHQELYPPPPPRPSYPERQYSCTSLQGPG 76

  Fly   245 QGMMHQGQGPPQMHQGHPGQHTP---PSQNPNSQSSGMPSP----------------------LY 284
            ....|   ||.|....||.:..|   |:  |.|.:|..|||                      :|
  Rat    77 NSRAH---GPAQAGHHHPEKSQPLCEPA--PLSGASASPSPAPPACSQPAPDHPSSAASKQPIVY 136

  Fly   285 PWMRSQFGKCQ-----------ERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTE 338
            |||:    |..           |.||.|..|||.|.||||||||:||||||||||||||:|||:|
  Rat   137 PWMK----KIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIEIAHSLCLSE 197

  Fly   339 RQIKIWFQNRRMKWKKEN-----KTKGEPGSGG---------------EGDEITPP 374
            ||||||||||||||||::     |.:..|.:|.               .....|||
  Rat   198 RQIKIWFQNRRMKWKKDHRLPNTKVRSAPPAGAAPSTLSAATPGTSEDHSQSATPP 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 35/161 (22%)
Homeobox 301..354 CDD:395001 45/52 (87%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 45/53 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.