DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Hoxb8

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus


Alignment Length:201 Identity:81/201 - (40%)
Similarity:99/201 - (49%) Gaps:55/201 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 NHHNMGMYQQQSGVPPVGAPPQ---GMMHQGQ------GPPQMH-------------QGHPG--- 263
            |:::.|..|...|.|.|...|.   ...|..|      ||..:.             .|.||   
  Rat    22 NYYDCGFAQDLGGRPTVVYGPSSGGSFQHPSQIQEFYHGPSSLSTAPYQQNPCAVACHGDPGNFY 86

  Fly   264 -------QHTPPSQNPN---------------------SQSSGMPSPLYPWMRSQFGKCQERKRG 300
                   |....:|:|:                     |:.|..|:.|:||||.|  ....|:||
  Rat    87 GYDPLQRQSLFGAQDPDLVQYADCKLAAASGLGEEAEGSEQSPSPTQLFPWMRPQ--AAAGRRRG 149

  Fly   301 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSG 365
            ||||:|||||||||||.||.||||:||||::|||.|||||:|||||||||||||||.....|.|.
  Rat   150 RQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENNKDKFPSSK 214

  Fly   366 GEGDEI 371
            .|.:|:
  Rat   215 CEQEEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 33/134 (25%)
Homeobox 301..354 CDD:395001 44/52 (85%)
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X14
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.