DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Vax1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_033527.1 Gene:Vax1 / 22326 MGIID:1277163 Length:338 Species:Mus musculus


Alignment Length:165 Identity:47/165 - (28%)
Similarity:66/165 - (40%) Gaps:35/165 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSSGMPSPLY---PWMRSQFGKCQE------ 296
            |:.|...:.:.||      ...|.......| .|:|:....|.|   ..:|...|..:|      
Mouse    37 GSLPAAFLKEPQG------AFSGSGASEDCN-KSKSNSSADPDYCRRILVRDAKGSIREIILPKG 94

  Fly   297 -----RKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 356
                 .||.|.::|..|...||.||...:|:..|.|.|:|..|.|:|.|:|:||||||.|.||:.
Mouse    95 LDLDRPKRTRTSFTAEQLYRLEMEFQRCQYVVGRERTELARQLNLSETQVKVWFQNRRTKQKKDQ 159

  Fly   357 KTKGEPGSG--------------GEGDEITPPNSP 377
            ....|..|.              .:|..::||..|
Mouse   160 GKDSELRSVVSETAATCSVLRLLEQGRLLSPPGLP 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/78 (21%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
Vax1NP_033527.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..69 8/38 (21%)
Homeodomain 101..157 CDD:459649 26/55 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..269
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..338
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.