DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and GSX1

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_663632.1 Gene:GSX1 / 219409 HGNCID:20374 Length:264 Species:Homo sapiens


Alignment Length:229 Identity:73/229 - (31%)
Similarity:93/229 - (40%) Gaps:66/229 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 PEGGSPPLVDQMSGHHMNAQMTLPHHMGHPQAQLGYT-------DVGV----PDVTEVHQNHHNM 228
            |||..|||              .|:.:..|.|..|.:       ..|:    |......|.|...
Human    21 PEGSPPPL--------------FPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPP 71

  Fly   229 G---MYQQQSGVPPVGA----PPQGMMHQGQGPPQMHQGHPG---------QHTPPSQNP----- 272
            |   :...::..||.|:    .|.|..|....|...|  .|.         |.:.|..:|     
Human    72 GPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAH--GPAAAAAAAALYQTSYPLPDPRQFHC 134

  Fly   273 ---NSQSSGMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHAL 334
               :|.|:.:||               .||.|..:|..|.||||:||..|.||:|.||||||..|
Human   135 ISVDSSSNQLPS---------------SKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYL 184

  Fly   335 CLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEG 368
            .|:|:|:||||||||:|.|||.|.....|.||.|
Human   185 NLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGG 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 34/165 (21%)
Homeobox 301..354 CDD:395001 32/52 (62%)
GSX1NP_663632.1 SNAG domain. /evidence=ECO:0000250 1..20
Homeobox 151..204 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..264 9/18 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X14
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.