DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Shox2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_038693.1 Gene:Shox2 / 20429 MGIID:1201673 Length:331 Species:Mus musculus


Alignment Length:118 Identity:31/118 - (26%)
Similarity:53/118 - (44%) Gaps:12/118 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 GAPPQGMMHQGQGPPQMHQGHP--GQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQ-ERKRGRQ 302
            |..|...:..|........|.|  .:.:|..::....:.||...         |:.: :::|.|.
Mouse    90 GRSPVRELDMGAAERSREPGSPRLTEVSPELKDRKDDAKGMEDE---------GQTKIKQRRSRT 145

  Fly   303 TYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 355
            .:|..|..|||:.|....|.....|.|::..|.|:|.::::||||||.|.:|:
Mouse   146 NFTLEQLNELERLFDETHYPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 11/67 (16%)
Homeodomain 298..354 CDD:459649 21/55 (38%)
Shox2NP_038693.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 26..140 9/58 (16%)
Homeodomain 141..197 CDD:459649 21/55 (38%)
OAR 311..327 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 313..326
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.