DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Prrx2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006497869.1 Gene:Prrx2 / 20204 MGIID:98218 Length:259 Species:Mus musculus


Alignment Length:157 Identity:38/157 - (24%)
Similarity:61/157 - (38%) Gaps:47/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   253 GPPQMHQGHPGQHTPPSQNPNSQSSG---------MPSPLYPWMRSQFGKCQERK----RGRQTY 304
            ||.:..:|       .::.|:..|||         .|||         |:..:||    |.|.|:
Mouse    57 GPAEAREG-------AAREPSGGSSGSEAAPQDGDCPSP---------GRGTKRKKKQRRNRTTF 105

  Fly   305 TRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQI------------KIWFQNRRMKWKKENK 357
            ...|...||:.|....|.....|.|:|..:.|:|.::            ::||||||.|:::..:
Mouse   106 NSSQLQALERVFERTHYPDAFVREELARRVNLSEARVQSTRPCSPHSPSQVWFQNRRAKFRRNER 170

  Fly   358 TKGEPGSG------GEGDEITPPNSPQ 378
            ......|.      |:...|..|.:|:
Mouse   171 AMLATRSASLLKSYGQEAAIEQPVAPR 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 16/65 (25%)
Homeodomain 298..354 CDD:459649 21/71 (30%)
Prrx2XP_006497869.1 Homeodomain 103..167 CDD:459649 18/63 (29%)
OAR 233..249 CDD:461067
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.