DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ceh-30

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_508524.2 Gene:ceh-30 / 191620 WormBaseID:WBGene00000451 Length:237 Species:Caenorhabditis elegans


Alignment Length:123 Identity:41/123 - (33%)
Similarity:62/123 - (50%) Gaps:26/123 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 HQGHPGQHTPPSQ--------NPNSQSSG---MPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLE 311
            :..|...|.|..|        :|.:.|.|   |.||         |.|::.::.|..:|..|..|
 Worm    54 NSSHSNDHDPSPQSIKSDFSTSPRASSPGGDRMGSP---------GSCKKSRKARTIFTDKQLQE 109

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKG-----EPGS 364
            ||..|...:||:.:.|:::||.:.||:.|:|.|:||||.|||:: .|.|     |||:
 Worm   110 LENTFEKQKYLSVQDRMDLAHRMGLTDTQVKTWYQNRRTKWKRQ-ATSGMDLLSEPGN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 13/58 (22%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
ceh-30NP_508524.2 Homeodomain 96..152 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.