DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and ceh-5

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_492586.2 Gene:ceh-5 / 191616 WormBaseID:WBGene00000430 Length:134 Species:Caenorhabditis elegans


Alignment Length:57 Identity:25/57 - (43%)
Similarity:38/57 - (66%) Gaps:0/57 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   298 KRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK 354
            ||.|..:|..|..:||:.|:.:.||:...|.::|.:|.|::.|:|:||||||.|.||
 Worm    36 KRPRTVFTDEQLEKLEESFNTSGYLSGSTRAKLAESLGLSDNQVKVWFQNRRTKQKK 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 3/7 (43%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
ceh-5NP_492586.2 Homeodomain 36..92 CDD:459649 23/55 (42%)

Return to query results.
Submit another query.