DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Pitx1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035227.1 Gene:Pitx1 / 18740 MGIID:107374 Length:315 Species:Mus musculus


Alignment Length:160 Identity:42/160 - (26%)
Similarity:60/160 - (37%) Gaps:43/160 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 MGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQNPNSQSS--------------- 277
            |.:.:...|:.|...||..|      .|..|.........|.:|..|:||               
Mouse     8 MSLERLPEGLRPPPPPPHDM------GPSFHLARAADPREPLENSASESSDADLPDKERGGEAKG 66

  Fly   278 -------------GMPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIE 329
                         |...|         .|.::::|.|..:|..|..|||..|..|||.....|.|
Mouse    67 PEDGGAGSAGCGGGAEDP---------AKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREE 122

  Fly   330 IAHALCLTERQIKIWFQNRRMKWKKENKTK 359
            ||....|||.::::||:|||.||:|..:.:
Mouse   123 IAVWTNLTEPRVRVWFKNRRAKWRKRERNQ 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 18/105 (17%)
Homeodomain 298..354 CDD:459649 25/55 (45%)
Pitx1NP_035227.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104 20/110 (18%)
Homeodomain 91..147 CDD:459649 25/55 (45%)
Interaction with PIT-1 151..280 0/2 (0%)
OAR 277..294 CDD:461067
OAR. /evidence=ECO:0000255|PROSITE-ProRule:PRU00138 281..294
Nuclear localization signal. /evidence=ECO:0000255 287..291
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.