DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Nkx3-1

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035051.1 Gene:Nkx3-1 / 18095 MGIID:97352 Length:237 Species:Mus musculus


Alignment Length:196 Identity:52/196 - (26%)
Similarity:76/196 - (38%) Gaps:62/196 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   233 QQSGVPPVGAPP-----------QGMMHQGQGPPQMHQGHPG--QHTP----------------- 267
            :..|..|..|||           |.::   :...:.|.||.|  ||:|                 
Mouse    13 EAGGRSPWAAPPTQSKRLTSFLIQDIL---RDRAERHGGHSGNPQHSPDPRRDSAPEPDKAGGRG 74

  Fly   268 --PSQNPNSQSSGMPSPLYPWMRSQFG----KC---------------QERKRGRQTYTRYQTLE 311
              |...|:.:.|...:|..|...:.|.    .|               |.:||.|..::..|.:|
Mouse    75 VAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHNPGDLASAPQVTKQPQKRSRAAFSHTQVIE 139

  Fly   312 LEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPNS 376
            ||::|...:||:...|..:|..|.|||.|:||||||||.|.|::..:        |...:...||
Mouse   140 LERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLS--------EDLGVLEKNS 196

  Fly   377 P 377
            |
Mouse   197 P 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 24/123 (20%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
Nkx3-1NP_035051.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..96 18/85 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 108..130 3/21 (14%)
Homeodomain 126..182 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.