DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Nkx2-9

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_032727.2 Gene:Nkx2-9 / 18094 MGIID:1270158 Length:235 Species:Mus musculus


Alignment Length:170 Identity:49/170 - (28%)
Similarity:75/170 - (44%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 QLGYTDVGVPDVTEVHQNHHNMGMYQQQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPPSQN 271
            :||:|...:.::.|  |:.......:||:.||...|     ..:.:....:.....|..|.|:.:
Mouse     6 RLGFTVRSLLNLPE--QDAKPRVRREQQTCVPQTAA-----WLESECSHYLSSDESGLETSPADS 63

  Fly   272 PNSQSSGMPSPLYPWMRSQFGKCQERKRGRQT-YTRYQTLELEKEFHFNRYLTRRRRIEIAHALC 335
            ....|....||         |...|::|.|:. :::.||||||:.|...|||:...|.::|..|.
Mouse    64 SQLASLRRESP---------GSDPEKRRKRRVLFSKAQTLELERRFRQQRYLSAPEREQLARLLR 119

  Fly   336 LTERQIKIWFQNRRMKWKKENKTKGEPGSGGEGDEITPPN 375
            ||..|:||||||.|.|.|:           |....||.|:
Mouse   120 LTPTQVKIWFQNHRYKLKR-----------GRAPGITEPS 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/99 (20%)
Homeodomain 298..354 CDD:459649 26/56 (46%)
Nkx2-9NP_032727.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..86 10/43 (23%)
Homeodomain 82..138 CDD:459649 26/55 (47%)

Return to query results.
Submit another query.