DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Nkx2-6

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035050.2 Gene:Nkx2-6 / 18092 MGIID:97351 Length:289 Species:Mus musculus


Alignment Length:174 Identity:48/174 - (27%)
Similarity:73/174 - (41%) Gaps:44/174 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 EVHQN---------HHNMGMYQ--QQSGVPPVGAPPQGMMHQGQGPPQMHQGHPGQHTPP----- 268
            |:|:|         :...|.::  .::...|.....:.::..|..|    .|.|  .|||     
Mouse    33 ELHRNPVKPRYLRMNQESGWFESSDRAQAVPFRCTWETVLEMGSNP----VGEP--QTPPGTISR 91

  Fly   269 --SQNPNSQS-----SG---MPSPLYPWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLT 323
              ::||.:..     ||   ...|:....|.|       ::.|..:::.|.|.||:.|...||||
Mouse    92 LGARNPMTDRGVGNLSGDMRRGGPVSTRTRPQ-------RKSRVLFSQAQVLALERRFKQQRYLT 149

  Fly   324 RRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTK-----GEP 362
            ...|..:|.||.||..|:||||||||.|.|.:.:.:     |.|
Mouse   150 APEREHLASALQLTSTQVKIWFQNRRYKSKSQRQDQTLELAGHP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 20/111 (18%)
Homeodomain 298..354 CDD:459649 26/55 (47%)
Nkx2-6NP_035050.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..125 14/62 (23%)
Homeodomain 124..179 CDD:459649 26/54 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 259..289
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.