DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and Nkx2-2

DIOPT Version :10

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_035049.1 Gene:Nkx2-2 / 18088 MGIID:97347 Length:273 Species:Mus musculus


Alignment Length:145 Identity:42/145 - (28%)
Similarity:62/145 - (42%) Gaps:29/145 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 APPQGMMHQGQG-----PPQ---MHQGHPGQHTPPSQNPNSQSSGMPSPLYPWMRSQFGKCQERK 298
            |..:|:.:...|     |||   .....|.....|..:..:|..|             |...:::
Mouse    78 ASTEGLQYSLHGLAASAPPQDSSSKSPEPSADESPDNDKETQGGG-------------GDAGKKR 129

  Fly   299 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTKGEPG 363
            :.|..:::.||.|||:.|...|||:...|..:|..:.||..|:||||||.|.|.|:....||.  
Mouse   130 KRRVLFSKAQTYELERRFRQQRYLSAPEREHLASLIRLTPTQVKIWFQNHRYKMKRARAEKGM-- 192

  Fly   364 SGGEGDEITPPNSPQ 378
                  |:||..||:
Mouse   193 ------EVTPLPSPR 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 12/71 (17%)
Homeodomain 298..354 CDD:459649 23/55 (42%)
Nkx2-2NP_035049.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..56
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 91..131 8/52 (15%)
Homeodomain 129..185 CDD:459649 23/55 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.