DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Antp and lim-6

DIOPT Version :9

Sequence 1:NP_996167.1 Gene:Antp / 40835 FlyBaseID:FBgn0260642 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001256980.1 Gene:lim-6 / 180459 WormBaseID:WBGene00002988 Length:316 Species:Caenorhabditis elegans


Alignment Length:107 Identity:33/107 - (30%)
Similarity:51/107 - (47%) Gaps:10/107 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   273 NSQSSGMPSPLY-PWMRSQFGKCQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCL 336
            |.|:...|.||. ..:||:..: :..||.|......|..:.:..|..:...:|:.|.::|:...|
 Worm   162 NFQTISNPDPLMEEVVRSEIHR-KTPKRPRTILNAQQRRQFKTAFERSSKPSRKVREQLANETGL 225

  Fly   337 TERQIKIWFQNRRMKWKKENKT--------KGEPGSGGEGDE 370
            :.|.:::||||:|.|.||.||.        |..|||.|...|
 Worm   226 SVRVVQVWFQNQRAKIKKLNKKDSDSGDTFKHGPGSEGRSTE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AntpNP_996167.1 KLF1_2_4_N <161..306 CDD:425360 10/33 (30%)
Homeobox 301..354 CDD:395001 14/52 (27%)
lim-6NP_001256980.1 LIM 42..95 CDD:295319
LIM 101..157 CDD:295319
Homeobox 189..242 CDD:278475 14/52 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3844
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.